PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021307-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7317.59 Da    PI: 11.5161
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021307-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.7e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +rien ++rqvtf+kRr g++KK +ELSvLCda++ +iifss+gkl+ey+s
  WALNUT_00021307-RA  9 SRIENRTRRQVTFAKRRVGLIKKTHELSVLCDAQIGLIIFSSNGKLFEYCS 59
                        59***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.38161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-27260IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRRKMSISR IENRTRRQVT FAKRRVGLIK KTHELSVLCD AQIGLIIFSS NGKLFEYCSE  60
TSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-20159159Myocyte-specific enhancer factor 2B
1tqe_Q4e-20159159Myocyte-specific enhancer factor 2B
1tqe_R4e-20159159Myocyte-specific enhancer factor 2B
1tqe_S4e-20159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212373.15e-31hypothetical protein PRUPE_ppa014844mg, partial
RefseqXP_008225844.16e-31PREDICTED: MADS-box protein FBP24 isoform X2
RefseqXP_008225845.16e-31PREDICTED: MADS-box protein FBP24 isoform X2
RefseqXP_008346100.12e-31PREDICTED: LOW QUALITY PROTEIN: MADS-box protein FBP24-like
SwissprotQ9ATE52e-28FBP24_PETHY; MADS-box protein FBP24
TrEMBLM5WIE05e-31M5WIE0_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_02s0025g02350.t011e-27(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.36e-27MIKC_MADS family protein